PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC6841_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 176aa    MW: 19421 Da    PI: 9.358
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC6841_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.21.8e-3860118260
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                 ++k+++cprC s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grr++k 
  RrC6841_p1  60 PDKIIACPRCTSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRRSKP 118
                 68999***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2959117IPR003851Zinc finger, Dof-type
PfamPF027011.3E-3162117IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.08164118IPR003851Zinc finger, Dof-type
PROSITE patternPS01361066102IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010214Biological Processseed coat development
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MATQDSPGIK LFGKTITFNA NNNIIQTIKK EEGQEQHPEL QTKAAVISPS TSDLTAEKRP  60
DKIIACPRCT SMETKFCYFN NYNVNQPRHF CKGCQRYWTA GGALRNVPVG AGRRRSKPPG  120
RVGGFSELLG AATGAVGQVE LDALLVEEWR AAASHSGFRH DFQVKRLRCY TDGQSC
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00166DAPTransfer from AT1G29160Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013595581.11e-119PREDICTED: dof zinc finger protein DOF1.5-like
RefseqXP_013709909.11e-119PREDICTED: dof zinc finger protein DOF1.5-like
SwissprotP683501e-102DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBLA0A0D3D6451e-119A0A0D3D645_BRAOL; Uncharacterized protein
STRINGBra010848.1-P1e-102(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28092669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.11e-104Dof family protein